PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S16830.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Nin-like
Protein Properties Length: 570aa    MW: 65034 Da    PI: 6.5032
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S16830.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.66.1e-29460511152
         RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    aek+isl+ l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Jcr4S16830.10 460 AEKTISLQILRQYFAGSLKDAAKSIGVCPTTLKRICRQHGINRWPSRKIKKV 511
                    589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.722448531IPR003035RWP-RK domain
PfamPF020429.1E-25463511IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MDRGASALIN STFSSTSVDL DFIDKPFAHG SWLRTTDKVN FLESDPFICS VQYLDSYHQF  60
SRKEMENLFD NPTPVYSGIG KCVVETDTCL VQSQEYVEDS DVLIQIWVPT KIAAQNVLTT  120
TDQPYSRNPS CWSLASYRNV SKAFHLTAEE DSKGNDECPQ KYCAELYNIS GCLALPVFEQ  180
ESGTCLAVVE IVTTTQKINY HLELEIVCKA LEAVDLKSSQ DFFPFCIKTC NEFYQIAITE  240
ISKILKSVCE INNLPLALTW ALCNRQGKNE YEQVSGKYDY YISTVDSACY MADSDLFGFY  300
KACSTQYLFL DQGIVGKAFT RNKQLFATDV TSFSKTSYPL SHHARMFNLR AALAIPLANM  360
YIGSIEFVLE LFLPRDCQDI EEQKHMWDFL PIVIQQSCRN FHVIMDKAKE NFAFVSRECL  420
KEEPEEEFKV ISHWDNNESE FSEFLIEQKL KRGEKRQTKA EKTISLQILR QYFAGSLKDA  480
AKSIGVCPTT LKRICRQHGI NRWPSRKIKK VNRSLKKLQL VVNSIRSDLV TEKSKIKQNT  540
QALARSSHAI QHSRAGIKEN QYGDSEPSMP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002532423.10.0PREDICTED: protein NLP2 isoform X1
RefseqXP_015582869.10.0PREDICTED: protein NLP2 isoform X1
SwissprotQ7X9B91e-132NLP2_ARATH; Protein NLP2
TrEMBLA0A067LB880.0A0A067LB88_JATCU; Uncharacterized protein
STRINGPOPTR_0009s16830.11e-165(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-122Nin-like family protein